Carrier-free (BSA/glycerol-free) PRMT5 mouse monoclonal antibody, clone OTI1F8
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PRMT5 mouse monoclonal antibody, clone OTI1F8
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Anti-PRMT5 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide peptide corresponding to a region derived from 622-637 amino acids of human protein arginine methyltransferase 5 |
USD 509.00
2 Weeks
PRMT5 mouse monoclonal antibody,clone OTI1F8, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
PRMT5 mouse monoclonal antibody,clone OTI1F8, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
PRMT5 Rabbit Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide of human PRMT5 |
Rabbit Polyclonal Anti-PRMT5 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PRMT5 antibody: synthetic peptide directed towards the N terminal of human PRMT5. Synthetic peptide located within the following region: FDFLCMPVFHPRFKREFIQEPAKNRPGPQTRSDLLLSGRDWNTLIVGKLS |
PRMT5 mouse monoclonal antibody,clone OTI3E6
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Goat Anti-PRMT5 Antibody
Applications | WB |
Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Pig, Dog, Cow) |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence RACREKDRDPEAQ, from the internal region of the protein sequence according to NP_006100.2; NP_001034708.1. |
PRMT5 mouse monoclonal antibody,clone OTI1F8
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |