Antibodies

View as table Download

Carrier-free (BSA/glycerol-free) PRMT5 mouse monoclonal antibody, clone OTI1F8

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-PRMT5 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide peptide corresponding to a region derived from 622-637 amino acids of human protein arginine methyltransferase 5

PRMT5 mouse monoclonal antibody,clone OTI1F8, Biotinylated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

PRMT5 mouse monoclonal antibody,clone OTI1F8, HRP conjugated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation HRP

PRMT5 Rabbit Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide of human PRMT5

Rabbit Polyclonal Anti-PRMT5 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PRMT5 antibody: synthetic peptide directed towards the N terminal of human PRMT5. Synthetic peptide located within the following region: FDFLCMPVFHPRFKREFIQEPAKNRPGPQTRSDLLLSGRDWNTLIVGKLS

PRMT5 mouse monoclonal antibody,clone OTI3E6

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Goat Anti-PRMT5 Antibody

Applications WB
Reactivities Human (Expected from sequence similarity: Mouse, Rat, Pig, Dog, Cow)
Conjugation Unconjugated
Immunogen Peptide with sequence RACREKDRDPEAQ, from the internal region of the protein sequence according to NP_006100.2; NP_001034708.1.

PRMT5 mouse monoclonal antibody,clone OTI1F8

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated