Antibodies

View as table Download

Anti-PRMT5 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide peptide corresponding to a region derived from 622-637 amino acids of human protein arginine methyltransferase 5

PRMT5 Rabbit Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide of human PRMT5

Rabbit Polyclonal Anti-PRMT5 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PRMT5 antibody: synthetic peptide directed towards the N terminal of human PRMT5. Synthetic peptide located within the following region: FDFLCMPVFHPRFKREFIQEPAKNRPGPQTRSDLLLSGRDWNTLIVGKLS

Goat Anti-PRMT5 Antibody

Applications WB
Reactivities Human (Expected from sequence similarity: Mouse, Rat, Pig, Dog, Cow)
Conjugation Unconjugated
Immunogen Peptide with sequence RACREKDRDPEAQ, from the internal region of the protein sequence according to NP_006100.2; NP_001034708.1.