Antibodies

View as table Download

Rabbit Polyclonal Anti-WNT2 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human WNT2

WNT3A Rabbit monoclonal antibody,clone OTIR4G6

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated

Rabbit Polyclonal antibody to WNT11 (wingless-type MMTV integration site family, member 11)

Applications IF, IHC, WB
Reactivities Human, Mouse (Predicted: Chicken, Rat, Xenopus, Bovine)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 310 of WNT11 (Uniprot ID#O96014)

Rabbit Polyclonal Anti-WNT3A Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human WNT3A

Rabbit Polyclonal Anti-BMP6 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human BMP6

Rabbit Polyclonal antibody to HHIP (hedgehog interacting protein)

Applications IF, IHC, WB
Reactivities Human, Mouse (Predicted: Rhesus Monkey)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 263 and 554 of HHIP (Uniprot ID#Q96QV1)

Rabbit polyclonal WNT5B Antibody (Center)

Applications FC, IHC, WB
Reactivities Human, Mouse (Predicted: Rat, Rabbit, Xenopus)
Conjugation Unconjugated
Immunogen This WNT5B antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 153-182 amino acids from the Central region of human WNT5B.

Rabbit polyclonal WNT10B Antibody (Center)

Applications FC, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This WNT10B antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 193-222 amino acids from the Central region of human WNT10B.

Rabbit Polyclonal Wnt10a Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Wnt10a antibody was raised against a 14 amino acid peptide from near the carboxy terminus of human Wnt10a.

Anti-BMP4 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 293-408 amino acids of human bone morphogenetic protein 4

Rabbit Polyclonal Anti-WNT10A Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human WNT10A

Rabbit Polyclonal Anti-WNT1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human WNT1

Rabbit Polyclonal Anti-WNT10B Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human WNT10B

Rabbit Polyclonal Anti-SHH Antibody

Applications IHC, WB
Reactivities Human, Mouse, Chicken
Conjugation Unconjugated
Immunogen The immunogen for anti-SHH antibody: synthetic peptide directed towards the N terminal of human SHH. Synthetic peptide located within the following region: RCLLLVLVSSLLVCSGLACGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKT

Rabbit Polyclonal Wnt-5a Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Bovine, Primate
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to amino acids 190-230 of human Wnt5A was used as the immunogen for this antibody, GenBank no NP_003383.2.