Anti-TBXAS1 (Thromboxane synthase) mouse monoclonal antibody, clone OTI1H9 (formerly 1H9)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Anti-TBXAS1 (Thromboxane synthase) mouse monoclonal antibody, clone OTI1H9 (formerly 1H9)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Anti-TBXAS1 (Thromboxane synthase) mouse monoclonal antibody, clone OTI1C3 (formerly 1C3)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Anti-TBXAS1 (Thromboxane synthase) mouse monoclonal antibody, clone OTI1A9 (formerly 1A9)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
TBXAS1 (Center) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide between 234-266 amino acids from the Central region of Human CYP5A1. |
Anti-TBXAS1 (Thromboxane synthase) mouse monoclonal antibody, clone OTI1A12 (formerly 1A12)
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit polyclonal anti-THAS antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human THAS. |
Rabbit anti-TBXAS1 Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human TBXAS1 |
Rabbit Polyclonal Anti-TBXAS1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TBXAS1 antibody is: synthetic peptide directed towards the C-terminal region of Human TBXAS1. Synthetic peptide located within the following region: GYEIITNTLSFATYLLATNPDCQEKLLREVDVFKEKHMAPEFCSLEEGLP |
Rabbit Polyclonal Anti-TBXAS1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TBXAS1 antibody is: synthetic peptide directed towards the C-terminal region of Human TBXAS1. Synthetic peptide located within the following region: LDARHSASPMGVQDFDIVRDVFSSTGCKPNPSRQHQPSPMARPLTVDEIV |
Anti-TBXAS1 (Thromboxane synthase) mouse monoclonal antibody, clone OTI1B8 (formerly 1B8)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |