USD 447.00
In Stock
NR1H4 mouse monoclonal antibody,clone OTI4F12
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 447.00
In Stock
NR1H4 mouse monoclonal antibody,clone OTI4F12
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NR1H4 mouse monoclonal antibody,clone OTI4F12
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 509.00
2 Weeks
NR1H4 mouse monoclonal antibody,clone OTI4F12, Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 509.00
2 Weeks
NR1H4 mouse monoclonal antibody,clone OTI4F12, HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
Rabbit Polyclonal FXR Antibody
Applications | ICC/IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to the C-terminus of the human FXR protein. |
Rabbit Polyclonal Anti-NR1H4 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NR1H4 antibody: synthetic peptide directed towards the middle region of human NR1H4. Synthetic peptide located within the following region: AECLLTEIQCKSKRLRKNVKQHADQTVNEDSEGRDLRQVTSTTKSCREKT |
USD 200.00
2 Days
NR1H4 mouse monoclonal antibody,clone OTI4F12
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-NR1H4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NR1H4 antibody: synthetic peptide directed towards the middle region of human NR1H4. Synthetic peptide located within the following region: SAVEAMFLRSAEIFNKKLPSGHSDLLEERIRNSGISDEYITPMFSFYKSI |
Goat Polyclonal Antibody against Farnesoid X receptor / HRR1
Applications | WB |
Reactivities | Human (Expected from sequence similarity: Dog) |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence KSCREKTELTPDQQ, from the internal region of the protein sequence according to NP_005114.1. |
NR1H4 Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of human NR1H4 |