Aryl hydrocarbon Receptor (AHR) (N-term) rabbit polyclonal antibody
Applications | ELISA, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic AhR peptide - KLH conjugated |
Aryl hydrocarbon Receptor (AHR) (N-term) rabbit polyclonal antibody
Applications | ELISA, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic AhR peptide - KLH conjugated |
Rabbit polyclonal AhR (Ser36) antibody(Phospho-specific)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human AhR around the phosphorylation site of serine 36 (N-P-SP-K-R). |
Modifications | Phospho-specific |
Rabbit Polyclonal Anti-AHR Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-AHR antibody: synthetic peptide directed towards the N terminal of human AHR. Synthetic peptide located within the following region: RAKSFFDVALKSSPTERNGGQDNCRAANFREGLNLQEGEFLLQALNGFVL |
Rabbit polyclonal AhR (Ab-36) antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human AhR around the phosphorylation site of serine 36 (N-P-SP-K-R). |
Rabbit Polyclonal anti-AHR antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-AHR antibody: synthetic peptide directed towards the N terminal of human AHR. Synthetic peptide located within the following region: MNSSSANITYASRKRRKPVQKTVKPIPAEGIKSNPSKRHRDRLNTELDRL |
Goat Polyclonal AHR Antibody
Applications | ChIP, ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | N-terminal sequence of Aryl hydrocarbon Receptor purified from C57BL/6J mice. [UniProt# P30561] |
Rabbit Polyclonal AhR (Ser36) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human AhR around the phosphorylation site of Serine 36 |
Modifications | Phospho-specific |
Aryl hydrocarbon Receptor (AHR) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal AhR Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human AhR |
Goat Anti-Aryl Hydrocarbon Receptor (aa749-763) Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-KHGLNPQSAIITPQT, from the internal region of the protein sequence according to NP_001612.1. |