USD 224.00
USD 447.00
In Stock
PPARA (PPAR alpha) mouse monoclonal antibody, clone OTI1E8 (formerly 1E8)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 224.00
USD 447.00
In Stock
PPARA (PPAR alpha) mouse monoclonal antibody, clone OTI1E8 (formerly 1E8)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 224.00
USD 447.00
In Stock
PPARA (PPAR alpha) mouse monoclonal antibody, clone OTI2G6 (formerly 2G6)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PPARA mouse monoclonal antibody, clone OTI2G6 (formerly 2G6)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 224.00
USD 447.00
In Stock
PPARA (PPAR alpha) mouse monoclonal antibody, clone OTI2E7 (formerly 2E7)
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PPARA mouse monoclonal antibody, clone OTI2E7 (formerly 2E7)
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 224.00
USD 447.00
In Stock
PPARA (PPAR alpha) mouse monoclonal antibody, clone OTI1E11 (formerly 1E11)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 224.00
USD 447.00
In Stock
PPARA (PPAR alpha) mouse monoclonal antibody, clone OTI2D10 (formerly 2D10)
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 224.00
USD 447.00
In Stock
PPARA (PPAR alpha) mouse monoclonal antibody, clone OTI3G3 (formerly 3G3)
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 224.00
USD 447.00
In Stock
PPARA (PPAR alpha) mouse monoclonal antibody, clone OTI2F3 (formerly 2F3)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PPARA mouse monoclonal antibody, clone OTI2D10 (formerly 2D10)
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PPARA mouse monoclonal antibody, clone OTI3G3 (formerly 3G3)
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PPARA mouse monoclonal antibody, clone OTI1E8 (formerly 1E8)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PPARA mouse monoclonal antibody, clone OTI1E11 (formerly 1E11)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PPARA mouse monoclonal antibody, clone OTI2F3 (formerly 2F3)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-RXRA Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-RXRA Antibody: synthetic peptide directed towards the N terminal of human RXRA. Synthetic peptide located within the following region: DTKHFLPLDFSTQVNSSLTSPTGRGSMAAPSLHPSLGPGIGSPGQLHSPI |