Antibodies

View as table Download

Rabbit Anti-Testicular Receptor 4 (TR4) Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein from the N-terminal region of mouse TR4

Rabbit Polyclonal Anti-NR2C2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NR2C2 antibody: synthetic peptide directed towards the N terminal of human NR2C2. Synthetic peptide located within the following region: INKHHRNRCQFCRLKKCLEMGMKMESVQSERKPFDVQREKPSNCAASTEK

Rabbit Polyclonal Anti-NR2C2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NR2C2 antibody: synthetic peptide directed towards the N terminal of human NR2C2. Synthetic peptide located within the following region: FTSLNKEKIVTDQQTGQKIQIVTAVDASGSPKQQFILTSPDGAGTGKVIL

NR2C2 mouse monoclonal antibody, clone OTI1D6 (formerly 1D6)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

NR2C2 mouse monoclonal antibody, clone OTI1C4 (formerly 1C4)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

NR2C2 mouse monoclonal antibody, clone OTI7E6 (formerly 7E6)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated