Antibodies

View as table Download

Rabbit anti-NR1H3 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human NR1H3

Rabbit Polyclonal Anti-NR1H3 Antibody

Applications WB
Reactivities Mouse, Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NR1H3 antibody: synthetic peptide directed towards the C terminal of human NR1H3. Synthetic peptide located within the following region: IHHPHDRLMFPRMLMKLVSLRTLSSVHSEQVFALRLQDKKLPPLLSEIWD