Antibodies

Jump to Filters
View as table Download
MUM1 (IRF4) (Center) Rabbit Polyclonal Antibody
AP52236PU-N

USD 580.00

2 Weeks

MUM1 (IRF4) (Center) rabbit polyclonal antibody, Purified

Applications FC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 171-199 amino acids from the Central region of human IRF4
MUM1 (IRF4) Rabbit Polyclonal Antibody
TA335827

USD 539.00

5 Days

Rabbit Polyclonal Anti-IRF4 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-IRF4 Antibody: synthetic peptide directed towards the N terminal of human IRF4. Synthetic peptide located within the following region: MNLEGGGRGGEFGMSAVSCGNGKLRQWLIDQIDSGKYPGLVWENEEKSIF
MUM1 (IRF4) Rabbit Polyclonal Antibody
TA351302

USD 380.00

In Stock

Rabbit Polyclonal Anti-IRF4 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human IRF4
MUM1 (IRF4) Rabbit Polyclonal Antibody
TA335828

USD 539.00

5 Days

Rabbit Polyclonal Anti-IRF4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-IRF4 Antibody: synthetic peptide directed towards the middle region of human IRF4. Synthetic peptide located within the following region: TAHVEPLLARQLYYFAQQNSGHFLRGYDLPEHISNPEDYHRSIRHSSIQE
MUM1 (IRF4) Rabbit Polyclonal Antibody
TA314093

USD 380.00

In Stock

Rabbit polyclonal anti-IRF4 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human IRF4.
MUM1 (IRF4) Goat Polyclonal Antibody
TA311234

USD 520.00

5 Days

Goat Anti-IRF4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-HISNPEDYHRSIR, from the C Terminus of the protein sequence according to NP_002451.2.
MUM1 (IRF4) Rat Monoclonal Antibody [Clone ID: IRF4.3E4]
TA327948

USD 500.00

5 Days

Rat Monoclonal anti-IRF4 Antibody

Applications WB
Reactivities Mouse, Human
Conjugation Unconjugated
MUM1 (IRF4) Rabbit Polyclonal Antibody
TA331103

USD 485.00

5 Days

Rabbit Polyclonal Anti-IRF4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IRF4 antibody: synthetic peptide directed towards the N terminal of human IRF4. Synthetic peptide located within the following region: LDISDPYKVYRIVPEGAKKGAKQLTLEDPQMSMSHPYTMTTPYPSLPAQQ
MUM1 (IRF4) Rabbit Polyclonal Antibody
TA347745

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-IRF4 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-IRF4 Antibody: A synthesized peptide derived from human IRF4