Rabbit polyclonal pRb2 p130 antibody
| Applications | WB |
| Reactivities | Human, Chimpanzee |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared by repeated immunizations with a synthetic peptide corresponding to the Spa310 sequence of pRb2/p130 protein. A residue of cysteine was added to facilitate coupling. |
Rabbit Polyclonal anti-RBL2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-RBL2 antibody is: synthetic peptide directed towards the C-terminal region of Human RBL2. Synthetic peptide located within the following region: NETMLSPREKIFYYFSNSPSKRLREINSMIRTGETPTKKRGILLEDGSES |
Rabbit Polyclonal Anti-RBL2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-RBL2 antibody is: synthetic peptide directed towards the C-terminal region of Human RBL2. Synthetic peptide located within the following region: SKRLREINSMIRTGETPTKKRGILLEDGSESPAKRICPENHSALLRRLQD |
Germany
Japan
United Kingdom
China