PRDX6 mouse monoclonal antibody, clone OTI11B8
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
PRDX6 mouse monoclonal antibody, clone OTI11B8
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
PRDX6 mouse monoclonal antibody, clone OTI4D1
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
PRDX6 mouse monoclonal antibody, clone OTI3A4
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PRDX6 mouse monoclonal antibody, clone OTI4D1
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PRDX6 mouse monoclonal antibody, clone OTI3A4
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PRDX6 mouse monoclonal antibody, clone OTI11B8
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Anti-PRDX6 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 8-224 amino acids of human peroxiredoxin 6 |
Anti-PRDX6 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 8-224 amino acids of human peroxiredoxin 6 |
Peroxiredoxin-6 / PRDX6 mouse monoclonal antibody, clone AT22E7, Purified
Applications | ELISA, FC, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Peroxiredoxin-6 / PRDX6 mouse monoclonal antibody, clone AT22E7, Purified
Applications | ELISA, FC, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
PRDX6 mouse monoclonal antibody, clone OTI11B8
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit anti-PRDX6 Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PRDX6 |
Rabbit Polyclonal Anti-PRDX6 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PRDX6 antibody: synthetic peptide directed towards the C terminal of human PRDX6. Synthetic peptide located within the following region: VATPVDWKDGDSVMVLPTIPEEEAKKLFPKGVFTKELPSGKKYLRYTPQP |
PRDX6 Goat Polyclonal Antibody
Applications | WB |
Reactivities | Human, Pig (Expected from sequence similarity: Dog, Cow) |
Conjugation | Unconjugated |
Immunogen | internal region (TAEKRVATPVD) |
PRDX6 mouse monoclonal antibody, clone OTI4D1
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |