Antibodies

Jump to Filters
View as table Download
BLBP (FABP7) Mouse Monoclonal Antibody [Clone ID: AT1D1]
AM09059PU-S

USD 315.00

3 Weeks

BLBP (FABP7) mouse monoclonal antibody, clone AT1D1, Purified

Applications ELISA, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
BLBP (FABP7) Rabbit Polyclonal Antibody
TA323168

USD 380.00

4 Weeks

Anti-FABP7 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein
TA323168 is a possible alternative to TA323167.
BLBP (FABP7) Rabbit Polyclonal Antibody
TA306442

USD 570.00

In Stock

Rabbit Polyclonal FABP7 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen FABP7 antibody was raised against a 17 amino acid peptide from near the center of human FABP7.
BLBP (FABP7) Mouse Monoclonal Antibody [Clone ID: AT1D1]
AM09059PU-N

USD 430.00

3 Weeks

BLBP (FABP7) mouse monoclonal antibody, clone AT1D1, Purified

Applications ELISA, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
BLBP (FABP7) Rabbit Polyclonal Antibody
TA334290

USD 485.00

5 Days

Rabbit Polyclonal Anti-FABP7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FABP7 antibody: synthetic peptide directed towards the N terminal of human FABP7. Synthetic peptide located within the following region: NFDEYMKALGVGFATRQVGNVTKPTVIISQEGDKVVIRTLSTFKNTEISF