Goat Polyclonal Antibody against HIP2
| Applications | WB |
| Reactivities | Human (Expected from sequence similarity: Mouse, Dog, Pig, Cow) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-SWDVETATELLLSN, from the C Terminus of the protein sequence according to NP_005330. |
Rabbit Polyclonal Anti-UBE2K Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-UBE2K antibody: synthetic peptide directed towards the middle region of human UBE2K. Synthetic peptide located within the following region: TVLLSLQALLAAAEPDDPQDAVVANQYKQNPEMFKQTARLWAHVYAGAPV |
Rabbit Polyclonal Anti-UBE2K Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-UBE2K antibody: synthetic peptide directed towards the N terminal of human UBE2K. Synthetic peptide located within the following region: FTELRGEIAGPPDTPYEGGRYQLEIKIPETYPFNPPKVRFITKIWHPNIS |
Germany
Japan
United Kingdom
China