Antibodies

Jump to Filters
View as table Download
SH3GL2 Rabbit Polyclonal Antibody
TA332852

USD 365.00

3 Weeks

Rabbit anti-SH3GL2 Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human SH3GL2
SH3GL2 Rabbit Polyclonal Antibody
TA342207

USD 539.00

5 Days

Rabbit polyclonal Anti-SH3GL2 Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-SH3GL2 antibody: synthetic peptide directed towards the N terminal of human SH3GL2. Synthetic peptide located within the following region: INTMSKIRGQEKGPGYPQAEALLAEAMLKFGRELGDDCNFGPALGEVGEA
SH3GL2 Rabbit Polyclonal Antibody
TA342208

USD 539.00

5 Days

Rabbit polyclonal Anti-SH3GL2 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-SH3GL2 antibody: synthetic peptide directed towards the middle region of human SH3GL2. Synthetic peptide located within the following region: PRREYQPKPRMSLEFPTGDSTQPNGGLSHTGTPKPSGVQMDQPCCRALYD