Germany
Japan
United Kingdom
China
Rabbit Polyclonal Met Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Met |
Antibodies
View as table Download
Rabbit Polyclonal Met Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Met |
Rabbit Polyclonal c-Met (Tyr1003) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human c-Met around the phosphorylation site of Tyrosine 1003 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Met (Tyr1234) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Met around the phosphorylation site of Tyrosine 1234 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Met (Tyr1349) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Met around the phosphorylation site of Tyrosine 1349 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-HGF Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HGF antibody: synthetic peptide directed towards the N terminal of human HGF. Synthetic peptide located within the following region: GESYRGLMDHTESGKICQRWDHQTPHRHKFLPERYPDKGFDDNYCRNPDG |
Rabbit polyclonal anti-TGF beta3 antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human TGF β3. |
Rabbit Polyclonal GLUT1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against a synthesized A synthesized peptide derived from human GLUT1. |
Rabbit Polyclonal Anti-HGF Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HGF antibody: synthetic peptide directed towards the middle region of human HGF. Synthetic peptide located within the following region: NENYCRNPDDDAHGPWCYTGNPLIPWDYCPISRCEGDTTPTIVNLDHPVI |
Rabbit Polyclonal Anti-TGF alpha Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TGF alpha Antibody: A synthesized peptide derived from human TGF alpha |
Rabbit anti-HGF Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human HGF |
Rabbit polyclonal Met (Tyr1349) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Met around the phosphorylation site of tyrosine 1349 (E-H-YP-V-H). |
| Modifications | Phospho-specific |
Active filters
Category
-
Antibodies
- Primary Antibodies
Applications
- WB
Isotypes
- IgG
Conjugates
- Unconjugated
Families
- Transmembrane
Pathways
- Renal cell carcinoma