HOXD10 mouse monoclonal antibody,clone OTI1D11
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
HOXD10 mouse monoclonal antibody,clone OTI1D11
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HOXD10 mouse monoclonal antibody,clone OTI1D11
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
HOXD10 mouse monoclonal antibody,clone OTI1D11
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
HOXD10 mouse monoclonal antibody, clone OTI1F7 (formerly 1F7)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HOXD10 mouse monoclonal antibody, clone OTI1F7 (formerly 1F7)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
HOXD10 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human, Mouse, Zebrafish |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide between 305-334 amino acids from the C-terminal region of Human HOXD10 |
Goat Anti-HOXD10 Antibody
Applications | WB |
Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Horse, Cow) |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence PNRSCRIEQPVTQQ, from the internal region of the protein sequence according to NP_002139.2. |
Rabbit Polyclonal Anti-HOXD10 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HOXD10 antibody: synthetic peptide directed towards the middle region of human HOXD10. Synthetic peptide located within the following region: NPEVPVPGYFRLSQTYATGKTQEYNNSPEGSSTVMLQLNPRGAAKPQLSA |
HOXD10 mouse monoclonal antibody, clone OTI1F7 (formerly 1F7)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |