Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal antibody to CD44 (CD44 molecule (Indian blood group))
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 1 and 258 of CD44 |
Rabbit polyclonal anti-HDAC-1 antibody
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Anti-HDAC-1 antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 466-482 of Human HDAC-1. |
Rabbit Polyclonal anti-STAT6 antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-STAT6 antibody: synthetic peptide directed towards the C terminal of human STAT6. Synthetic peptide located within the following region: NLYPKKPKDEAFRSHYKPEQMGKDGRGYVPATIKMTVERDQPLPTPELQM |
DLL4 rabbit polyclonal antibody, Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to the internal region of human DLL4. |
Rabbit polyclonal Cyclin E1 (Ab-395) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Cyclin E1 around the phosphorylation site of threonine 395 (L-L-T-P-P). |
Rabbit polyclonal Phospho-STAT5a(Y694) Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This STAT5a Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding Y694 of human STAT5a. |
| Modifications | Phospho-specific |
Rabbit Polyclonal CD44 (Ser706) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human CD44 around the phosphorylation site of Serine 706 |
| Modifications | Phospho-specific |
Active filters
Category
-
Antibodies
- Primary Antibodies
Applications
- WB
Isotypes
- IgG
Conjugates
- Unconjugated
Families
- Stem cell relevant signaling - DSL/Notch pathway
Filter by
Target Symbol
Reactivities
Antibody Hosts
Clonalities
Modifications
Assay Types
Pathways
- Pathways in cancer (45)
- Jak-STAT signaling pathway (34)
- Chronic myeloid leukemia (33)
- Cell cycle (28)
- Notch signaling pathway (27)
- Acute myeloid leukemia (20)
- Prostate cancer (15)
- Small cell lung cancer (15)
- p53 signaling pathway (15)
- Huntington's disease (13)
- ErbB signaling pathway (12)
- Bladder cancer (8)
- Colorectal cancer (8)
- Endometrial cancer (8)
- Focal adhesion (8)
- Glioma (8)
- Melanoma (8)
- Non-small cell lung cancer (8)
- Pancreatic cancer (8)
- Thyroid cancer (8)
- Viral myocarditis (8)
- Wnt signaling pathway (8)
- Oocyte meiosis (7)
- Dorso-ventral axis formation (6)
- Prion diseases (6)
- Basal cell carcinoma (5)
- ECM-receptor interaction (5)
- Hedgehog signaling pathway (5)
- Hematopoietic cell lineage (5)
- Cytokine-cytokine receptor interaction (1)