Antibodies

Jump to Filters
View as table Download
Cytochrome P450 2C9 (CYP2C9) Mouse Monoclonal Antibody [Clone ID: OTI1D7]
TA503796

USD 447.00

In Stock

CYP2C9 (Cytochrome P450 2C9) mouse monoclonal antibody, clone OTI1D7 (formerly 1D7)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Cytochrome P450 2C9 (CYP2C9) Mouse Monoclonal Antibody [Clone ID: OTI1D7]
CF503796

USD 600.00

3 Days

Carrier-free (BSA/glycerol-free) CYP2C9 mouse monoclonal antibody, clone OTI1D7 (formerly 1D7)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Cytochrome P450 2C9 (CYP2C9) Mouse Monoclonal Antibody [Clone ID: OTI1D7]
TA503796S

USD 200.00

2 Days

CYP2C9 (Cytochrome P450 2C9) mouse monoclonal antibody, clone OTI1D7 (formerly 1D7)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Cytochrome P450 2C9 (CYP2C9) Rabbit Polyclonal Antibody
TA346225

USD 539.00

5 Days

Rabbit Polyclonal Anti-CYP2C9 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CYP2C9 antibody: synthetic peptide directed towards the C terminal of human CYP2C9. Synthetic peptide located within the following region: AGMELFLFLTSILQNFNLKSLVDPKNLDTTPVVNGFASVPPFYQLCFIPV