Antibodies

Jump to Filters
View as table Download
FANCA Rabbit Polyclonal Antibody
TA308599

USD 625.00

5 Days

Rabbit polyclonal antibody to FACA (Fanconi anemia, complementation group A)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 220 of FANCA (Uniprot ID#O15360)
FANCA Rabbit Polyclonal Antibody
TA319302

USD 765.00

5 Days

Rabbit polyclonal anti-FANCA antibody

Applications WB
Reactivities Human, Chimpanzee
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 995-1009 of human FANCA protein.
FANCA Rabbit Polyclonal Antibody
TA346159

USD 539.00

2 Weeks

Rabbit Polyclonal Anti-FANCA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FANCA antibody: synthetic peptide directed towards the N terminal of human FANCA. Synthetic peptide located within the following region: KLSLSKVIDCDSSEAYANHSSSFIGSALQDQASRLGVPVGILSAGMVASS
FANCA Rabbit Polyclonal Antibody
TA336291

USD 485.00

5 Days

Rabbit Polyclonal FACA/FANCA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide within residues 1200-1300 of the human FANCA protein. [Swiss-Prot# O15360]