Anti-DCXR mouse monoclonal antibody, clone OTI4D11 (formerly 4D11)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Anti-DCXR mouse monoclonal antibody, clone OTI4D11 (formerly 4D11)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) DCXR mouse monoclonal antibody, clone OTI4D11 (formerly 4D11)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Anti-DCXR mouse monoclonal antibody, clone OTI9C9 (formerly 9C9)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) DCXR mouse monoclonal antibody, clone OTI9C9 (formerly 9C9)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Anti-DCXR mouse monoclonal antibody, clone OTI7D11 (formerly 7D11)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Anti-DCXR mouse monoclonal antibody, clone OTI4H10 (formerly 4H10)
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) DCXR mouse monoclonal antibody, clone OTI7D11 (formerly 7D11)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) DCXR mouse monoclonal antibody, clone OTI4H10 (formerly 4H10)
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Anti-DCXR mouse monoclonal antibody, clone OTI4D11 (formerly 4D11)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Goat Polyclonal Antibody against DCXR
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence GSTLPVEGGFWAC, from the C Terminus of the protein sequence according to NP_057370.1. |
Rabbit Polyclonal Anti-DCXR Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DCXR antibody: synthetic peptide directed towards the middle region of human DCXR. Synthetic peptide located within the following region: STKGALDMLTKVMALELGPHKIRVNAVNPTVVMTSMGQATWSDPHKAKTM |
Rabbit polyclonal antibody to L-xylulose reductase (dicarbonyl/L-xylulose reductase)
Applications | WB |
Reactivities | Human (Predicted: Mouse, Guinea Pig) |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region within amino acids 182 and 244 of DCXR (Uniprot ID#Q7Z4W1) |
Anti-DCXR mouse monoclonal antibody, clone OTI9C9 (formerly 9C9)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Anti-DCXR mouse monoclonal antibody, clone OTI7D11 (formerly 7D11)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Anti-DCXR mouse monoclonal antibody, clone OTI4H10 (formerly 4H10)
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |