Rabbit Polyclonal DNMT2 Antibody
| Applications | ELISA, WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DNMT2 antibody: mouse Dnmt2 (DNA methyltransferase 2), using a KLH-conjugated synthetic peptide containing an amino acid sequence from the N-terminal part of the protein (1). |
Rabbit Polyclonal Anti-TRDMT1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TRDMT1 antibody: synthetic peptide directed towards the N terminal of human TRDMT1. Synthetic peptide located within the following region: MILMSPPCQPFTRIGRQGDMTDSRTNSFLHILDILPRLQKLPKYILLENV |
Germany
Japan
United Kingdom
China
