Rabbit Polyclonal SPT2 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | SPT2 antibody was raised against a 15 amino acid synthetic peptide near the carboxy terminus of human SPT2. |
Rabbit Polyclonal SPT2 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | SPT2 antibody was raised against a 15 amino acid synthetic peptide near the carboxy terminus of human SPT2. |
Rabbit Polyclonal Anti-NEU1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NEU1 antibody: synthetic peptide directed towards the middle region of human NEU1. Synthetic peptide located within the following region: VWSKDDGVSWSTPRNLSLDIGTEVFAPGPGSGIQKQREPRKGRLIVCGHG |
Rabbit Polyclonal ASAH1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | ASAH1 antibody was raised against a 16 amino acid synthetic peptide near the carboxy terminus of the human ASAH1. The immunogen is located within amino acids 240 - 290 of ASAH1. |
Rabbit polyclonal NEU2 Antibody (N-term)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This NEU2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 23-50 amino acids from the N-terminal region of human NEU2. |
Rabbit Polyclonal Anti-ASAH2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human ASAH2 |
Rabbit Polyclonal Anti-SGPL1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human SGPL1 |
Rabbit polyclonal SPHK1 Antibody (Center)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Monkey |
Conjugation | Unconjugated |
Immunogen | This SPHK1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 286-315 amino acids from the Central region of human SPHK1. |
Rabbit polyclonal GC Antibody (Center)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse (Predicted: Bovine, Pig) |
Conjugation | Unconjugated |
Immunogen | This GC antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 337-365 amino acids from the Central region of human GC. |
Rabbit Polyclonal Anti-SPHK2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human SPHK2 |
Anti-PPAP2A Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 40-53 amino acids of human phosphatidic acid phosphatase type 2A |
Rabbit polyclonal anti-PHCA antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human PHCA. |
NEU4 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide between 430-461 amino acids from the C-terminal region of Human Sialidase-4 |
Rabbit Polyclonal antibody to GBA (glucosidase, beta, acid)
Applications | IF, IHC, WB |
Reactivities | Human (Predicted: Chimpanzee) |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 352 and 536 of GBA (Uniprot ID#P04062) |
Rabbit Polyclonal Anti-NEU3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NEU3 antibody is: synthetic peptide directed towards the C-terminal region of Human NEU3. Synthetic peptide located within the following region: EEEGLFGCLFECGTKQECEQIAFRLFTHREILSHLQGDCTSPGRNPSQFK |
Rabbit Polyclonal Anti-SPTLC1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human SPTLC1 |