Antibodies

View as table Download

Rabbit Polyclonal Anti-Alg8 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Alg8 Antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: LELKLLDPSQIPRASMTSGLVQQSQHTVLPSVSPSATLICTLIAILPSVF

ALG8 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human ALG8