Rabbit Polyclonal c-jun Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the Middle Region of the target protein. |
Rabbit Polyclonal c-jun Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the Middle Region of the target protein. |
Rabbit Polyclonal antibody to c-Myc (v-myc myelocytomatosis viral oncogene homolog (avian))
Applications | FC, IF, WB |
Reactivities | Human, Mouse (Predicted: Rat, Dog, Feline, Pig, Sheep, Chimpanzee, Bovine, Rhesus Monkey) |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region within amino acids 1 and 52 of c-Myc (Uniprot ID#P01106) |
Rabbit Polyclonal ELK1 Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Rabbit polyclonal JUN Antibody (C-term)
Applications | FC, IHC, WB |
Reactivities | Human (Predicted: Mouse, Rat, Bovine, Chicken, Pig) |
Conjugation | Unconjugated |
Immunogen | This JUN antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 222-251 amino acids from the C-terminal region of human JUN. |
Anti-STAT5B rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 46-351 amino acids of Human Signal transducer and activator of transcription 5B |
Rabbit polyclonal Phospho-cJun(S63) Antibody
Applications | Dot, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This cJun Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding S63 of human cJun. |
Modifications | Phospho-specific |
Rabbit polyclonal c-Jun (Ab-170) antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human c-Jun around the phosphorylation site of Tyrosine 170. |
Rabbit Polyclonal Anti-NRG1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human NRG1 |
Rabbit polyclonal Phospho-cJun(S63) Antibody
Applications | Dot, IHC, WB |
Reactivities | Human (Predicted: Mouse, Rat, Bovine) |
Conjugation | Unconjugated |
Immunogen | This cJun Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding S63 of human cJun. |
Modifications | Phospho-specific |
Rabbit polyclonal Phospho-STAT5a(Y694) Antibody
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This STAT5a Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding Y694 of human STAT5a. |
Modifications | Phospho-specific |
Rabbit polyclonal NRG1 isoform-10 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human NRG1 isoform-10. |
Rabbit Polyclonal CrkII (Tyr221) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human CrkII around the phosphorylation site of Tyrosine 221 |
Modifications | Phospho-specific |
Rabbit Polyclonal STAT5A (Ser780) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human STAT5A around the phosphorylation site of Serine 780 |
Modifications | Phospho-specific |
Rabbit Polyclonal STAT5A/B (Ser725/730) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human STAT5A/B around the phosphorylation site of Serine 725/730 |
Modifications | Phospho-specific |
Rabbit Polyclonal Anti-JUN Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-JUN antibody: synthetic peptide directed towards the N terminal of human JUN. Synthetic peptide located within the following region: TAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKP |