Rabbit Polyclonal Anti-MAML3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MAML3 antibody: synthetic peptide directed towards the middle region of human MAML3. Synthetic peptide located within the following region: YPVQQVNQFQGSPQDIAAVRSQAALQSMRTSRLMAQNAGMMGIGPSQNPG |
Rabbit Polyclonal Anti-DTX1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DTX1 antibody: synthetic peptide directed towards the N terminal of human DTX1. Synthetic peptide located within the following region: SRWRPYTATVCHHIENVLKEDARGSVVLGQVDAQLVPYIIDLQSMHQFRQ |
Rabbit Polyclonal Anti-CIR Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CIR antibody: synthetic peptide directed towards the C terminal of human CIR. Synthetic peptide located within the following region: RSRSPGSYKQRETRKRAQRNPGEEQSRRNDSRSHGTDLYRGEKMYREHPG |
Rabbit Polyclonal Anti-RBPJL Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-RBPJL antibody is: synthetic peptide directed towards the N-terminal region of Human RBPJL. Synthetic peptide located within the following region: DPAGAADPSVPPNPLTHLSLQDRSEMQLQSEADRRSLPGTWTRSSPEHTT |
Rabbit Polyclonal Anti-PCAF Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PCAF antibody: synthetic peptide directed towards the C terminal of human PCAF. Synthetic peptide located within the following region: PGLSCFKDGVRQIPIESIPGIRETGWKPSGKEKSKEPRDPDQLYSTLKSI |
Rabbit Polyclonal Anti-p300 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-p300 Antibody: A synthesized peptide derived from human p300 |
Rabbit Polyclonal Anti-p300 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-p300 Antibody: A synthesized peptide derived from human p300 |
Rabbit Polyclonal Anti-HDAC1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | HDAC1 antibody was raised against a 19 amino acid peptide near the carboxy terminus of human HDAC1. |
Rabbit Polyclonal anti-HDAC2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human HDAC2 |
Rabbit polyclonal HDAC2 (Ser394) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human HDAC2 around the phosphorylation site of serine 394 (E-D-SP-G-D). |
| Modifications | Phospho-specific |
Germany
Japan
United Kingdom
China