Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Oct-1 (POU2F1) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Goat Anti-POU2F1 / OCT1 Antibody
| Applications | WB |
| Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog, Cow, Pig) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-NVQSKSNEESGDSQQ, from the internal region (near N Terminus) of the protein sequence according to NP_002688.2. |
Rabbit Polyclonal Anti-POU2F1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-POU2F1 antibody: synthetic peptide directed towards the N terminal of human POU2F1. Synthetic peptide located within the following region: AISTAQAQAFLGHLHQVQLAGTSLQAAAQSLNVQSKSNEESGDSQQPSQP |
Rabbit anti-POU2F1 Polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human POU2F1 |
Rabbit Polyclonal Anti-POU2F1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-POU2F1 Antibody: synthetic peptide directed towards the N terminal of human POU2F1. Synthetic peptide located within the following region: MADGGAASQDESSAAAAAAADSRMNNPSETSKPSMESGDGNTGTQTNGLD |
Rabbit Polyclonal Anti-OCT1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-OCT1 Antibody: A synthesized peptide derived from human 41183 |
POU2F1 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N region of human POU2F1 |
POU2F1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human POU2F1 |
POU2F1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human POU2F1 |
Active filters
Category
-
Antibodies
- Primary Antibodies
Target Symbol
- OCT-1
Applications
- WB
Clonalities
- Polyclonal
Families
- Druggable Genome