Rabbit Polyclonal CD10 Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit Polyclonal CD10 Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Anti-MME Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide peptide corresponding to a region derived from 519-533 amino acids of human membrane metallo-endopeptidase |
Rabbit Polyclonal Anti-ACE Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human ACE |
CD13 (ANPEP) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide, corresponding to amino acids 880-930 of Human CD13. |
Rabbit polyclonal Neprilysin Antibody (C-term)
Applications | FC, IHC, WB |
Reactivities | Human (Predicted: Mouse, Rat, Rabbit) |
Conjugation | Unconjugated |
Immunogen | This Neprilysin antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 506-534 amino acids from the C-terminal region of human Neprilysin. |
Rabbit Polyclonal Aminopeptidase A/APA Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
USD 580.00
2 Weeks
Leucyl cystinyl aminopeptidase (LNPEP) (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide between 16-46 amino acids from the N-terminal region of Human LNPEP. |
Aminopeptidase A (ENPEP) (689-032) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Porcine, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein fragment containing a sequence corresponding to a region within amino acids 689 and 932 of Human ENPEP |
Aminopeptidase A (ENPEP) (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide between 906-938 amino acids from the C-terminal region of Human ENPEP. |
CTSA (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide between 25-53 amino acids from the N-terminal region of human CTSA |
Rabbit polyclonal CTSA / PPGB (32k, Cleaved-Arg326) antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human PPGB |
Rabbit Polyclonal Anti-CMA1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CMA1 antibody: synthetic peptide directed towards the C terminal of human CMA1. Synthetic peptide located within the following region: EVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVA |
Goat Polyclonal Antibody against ENPEP
Applications | IHC, WB |
Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog, Pig, Cow) |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-EQYQKTSLAQEKEK, from the internal region of the protein sequence according to NP_001968.2. |
CPA3 (Center) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide between 262-292 amino acids from the Central region of Human CPA3. |
Rabbit polyclonal MME Antibody (Center)
Applications | IF, WB |
Reactivities | Human, Mouse (Predicted: Rat) |
Conjugation | Unconjugated |
Immunogen | This MME antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 274-302 amino acids from the Central region of human MME. |