Antibodies

Jump to Filters
View as table Download
AKT1 Mouse Monoclonal Antibody [Clone ID: 960CT4.5.1]
TA325176

USD 580.00

5 Days

Mouse monoclonal AKT1 Antibody(Ascites)

Applications WB
Reactivities Human (Predicted: Mouse, Rat, Bovine)
Conjugation Unconjugated
Cyclin D1 (CCND1) Goat Polyclonal Antibody
TA329665

USD 520.00

5 Days

Goat Anti-cyclin D1 Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence TRFLSRVIKCDPD, from the internal region of the protein sequence according to NP_444284.1
PI 3 Kinase p55 gamma (PIK3R3) Rabbit Polyclonal Antibody
TA330913

USD 539.00

5 Days

Rabbit Polyclonal Anti-PIK3R3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PIK3R3 antibody is: synthetic peptide directed towards the C-terminal region of Human PIK3R3. Synthetic peptide located within the following region: DAVGKKLQEYHSQYQEKSKEYDRLYEEYTRTSQEIQMKRTAIEAFNETIK
IGF1 Rabbit Polyclonal Antibody
TA348004

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-IGF1 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-IGF1 antibody: A synthesized peptide derived from human IGF1
GRB2 Mouse Monoclonal Antibody [Clone ID: 5G3-E7-F11]
TA346955

USD 380.00

4 Weeks

Mouse Monoclonal GRB2 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated