Antibodies

View as table Download

Rabbit Polyclonal VMAT2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A genomic peptide made to an internal region of the human VMAT2 protein (within residues 30-200). [Swiss-Prot Q05940]

Rabbit Polyclonal Cleaved-caspase 3 antibody

Applications WB
Reactivities Mouse, Rat, Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Caspase 3.

Goat Polyclonal Antibody against PPID / CyP-40

Applications WB
Reactivities Human (Expected from sequence similarity: Mouse, Rat, Dog)
Conjugation Unconjugated
Immunogen Peptide with sequence C-DENFHYKHDREG, from the internal region of the protein sequence according to NP_005029.1.

Mouse Monoclonal UCHL1 / PGP9.5 Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated

Caspase 3 (CASP3) (full length) rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Bovine, Canine, Chicken, Guinea Pig, Hamster, Human, Monkey, Mouse, Porcine, Rabbit, Rat, Yeast
Conjugation Unconjugated
Immunogen Recombinant human Caspase-3 protein (full length)

Mouse Monoclonal Anti-Ubiquitin Antibody

Applications WB
Reactivities Human, Mouse, Rat, Bovine
Conjugation Unconjugated

Rabbit Polyclonal Anti-UQCRC2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-UQCRC2 antibody is: synthetic peptide directed towards the C-terminal region of Human UQCRC2. Synthetic peptide located within the following region: GIYTISQATAAGDVIKAAYNQVKTIAQGNLSNTDVQAAKNKLKAGYLMSV

Rabbit Polyclonal Anti-PGP9.5 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-PGP9.5 Antibody: A synthesized peptide derived from human PGP9.5

Rabbit Polyclonal Anti-COX6C Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-COX6C Antibody: A synthesized peptide derived from human COX6C