Rabbit Polyclonal VMAT2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A genomic peptide made to an internal region of the human VMAT2 protein (within residues 30-200). [Swiss-Prot Q05940] |
Rabbit Polyclonal VMAT2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A genomic peptide made to an internal region of the human VMAT2 protein (within residues 30-200). [Swiss-Prot Q05940] |
Rabbit Polyclonal Cleaved-caspase 3 antibody
Applications | WB |
Reactivities | Mouse, Rat, Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human Caspase 3. |
Goat Polyclonal Antibody against PPID / CyP-40
Applications | WB |
Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog) |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-DENFHYKHDREG, from the internal region of the protein sequence according to NP_005029.1. |
Mouse Monoclonal UCHL1 / PGP9.5 Antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Caspase 3 (CASP3) (full length) rabbit polyclonal antibody, Purified
Applications | IHC, WB |
Reactivities | Bovine, Canine, Chicken, Guinea Pig, Hamster, Human, Monkey, Mouse, Porcine, Rabbit, Rat, Yeast |
Conjugation | Unconjugated |
Immunogen | Recombinant human Caspase-3 protein (full length) |
Mouse Monoclonal Anti-Ubiquitin Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat, Bovine |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-UQCRC2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-UQCRC2 antibody is: synthetic peptide directed towards the C-terminal region of Human UQCRC2. Synthetic peptide located within the following region: GIYTISQATAAGDVIKAAYNQVKTIAQGNLSNTDVQAAKNKLKAGYLMSV |
Rabbit Polyclonal Anti-PGP9.5 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PGP9.5 Antibody: A synthesized peptide derived from human PGP9.5 |
Rabbit Polyclonal Anti-COX6C Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-COX6C Antibody: A synthesized peptide derived from human COX6C |