Antibodies

Jump to Filters

View as table

Loading...

Download Close

Download

1 - 7 of 7 results

(reset)

NM23A (NME1) Mouse Monoclonal Antibody [Clone ID: UMAB94]

UM800025

USD 564.00

In Stock

NME1 mouse monoclonal antibody,clone UMAB94

Applications	10k-ChIP, IF, IHC, WB
Reactivities	Human, Rat, Monkey, Dog
Conjugation	Unconjugated

• 

1 / 24

2 / 24

3 / 24

4 / 24

5 / 24

6 / 24

7 / 24

8 / 24

9 / 24

10 / 24

11 / 24

12 / 24

13 / 24

14 / 24

15 / 24

16 / 24

17 / 24

18 / 24

19 / 24

20 / 24

21 / 24

22 / 24

23 / 24

24 / 24

Previous Next

NM23A (NME1) Mouse Monoclonal Antibody [Clone ID: OTI4G3]

TA801245

USD 447.00

In Stock

NME1 mouse monoclonal antibody, clone OTI4G3 (formerly 4G3)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

NM23A (NME1) Mouse Monoclonal Antibody [Clone ID: OTI24A2]

CF801378

USD 600.00

3 Days

Carrier-free (BSA/glycerol-free) NME1 mouse monoclonal antibody, clone OTI24A2 (formerly 24A2)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

NM23A (NME1) Mouse Monoclonal Antibody [Clone ID: OTI4G3]

TA801245S

USD 200.00

In Stock

NME1 mouse monoclonal antibody, clone OTI4G3 (formerly 4G3)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

DNMT3B Rabbit Polyclonal Antibody

TA313761

USD 380.00

4 Weeks

Rabbit polyclonal anti-DNMT3B antibody

Applications	IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized peptide derived from N-terminal of human DNMT3B.

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

GOT2 Rabbit Polyclonal Antibody

TA325088

USD 580.00

2 Weeks

Rabbit polyclonal GOT2 Antibody (N-term)

Applications	FC, WB
Reactivities	Human (Predicted: Mouse, Rat, Bovine, Chicken, Pig, Monkey)
Conjugation	Unconjugated
Immunogen	This GOT2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 33-61 amino acids from the N-terminal region of human GOT2.

1 / 2

2 / 2

Previous Next

GOT2 Rabbit Polyclonal Antibody

TA332130

USD 539.00

5 Days

Rabbit Polyclonal Anti-GOT2 Antibody

Applications	WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for Anti-GOT2 Antibody: synthetic peptide directed towards the N terminal of human GOT2. Synthetic peptide located within the following region: VEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLPSVRKAEA

1 - 7 of 7 results