NME1 mouse monoclonal antibody,clone UMAB94
Applications | 10k-ChIP, IF, IHC, WB |
Reactivities | Human, Rat, Monkey, Dog |
Conjugation | Unconjugated |
NME1 mouse monoclonal antibody,clone UMAB94
Applications | 10k-ChIP, IF, IHC, WB |
Reactivities | Human, Rat, Monkey, Dog |
Conjugation | Unconjugated |
NME1 mouse monoclonal antibody, clone OTI4G3 (formerly 4G3)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NME1 mouse monoclonal antibody, clone OTI24A2 (formerly 24A2)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
NME1 mouse monoclonal antibody, clone OTI4G3 (formerly 4G3)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit polyclonal anti-DNMT3B antibody
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human DNMT3B. |
Rabbit polyclonal GOT2 Antibody (N-term)
Applications | FC, WB |
Reactivities | Human (Predicted: Mouse, Rat, Bovine, Chicken, Pig, Monkey) |
Conjugation | Unconjugated |
Immunogen | This GOT2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 33-61 amino acids from the N-terminal region of human GOT2. |
Rabbit Polyclonal Anti-GOT2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-GOT2 Antibody: synthetic peptide directed towards the N terminal of human GOT2. Synthetic peptide located within the following region: VEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLPSVRKAEA |