Rabbit Polyclonal VGF Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | VGF antibody was raised against a 17 amino acid synthetic peptide near the carboxy terminus of the human VGF. The immunogen is located within the last 50 amino acids of VGF. |
Rabbit Polyclonal Anti-VGF Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-VGF antibody: synthetic peptide directed towards the middle region of human VGF. Synthetic peptide located within the following region: ARQNALLFAEEEDGEAGAEDKRSQEETPGHRRKEAEGTEEGGEEEDDEEM |
Germany
Japan
United Kingdom
China
