Antibodies

View as table Download

IL1B mouse monoclonal antibody, clone OTI3E1 (formerly 3E1)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

IL6 mouse monoclonal antibody, clone OTI3G9 (formerly 3G9)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

IL6 mouse monoclonal antibody, clone OTI3G9 (formerly 3G9)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Anti-IL18 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Full length fusion protein
TA324190 is a possible alternative to TA324189.

Rabbit Polyclonal IL-1 beta/IL-1F2 Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide made to a C-terminal portion of the human IL 1 beta protein (between amino acids 100-200) [UniProt P01584]

IL1B mouse monoclonal antibody, clone OTI3E1 (formerly 3E1)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) IL-6 mouse monoclonal antibody, clone OTI2G3 (formerly 2G3)

Applications WB
Reactivities Human
Conjugation Unconjugated

IL6 goat polyclonal antibody, Aff - Purified

Applications ELISA, FN, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Highly pure (> 98%), 20.9 kDa  E.coli derived recombinant Human IL-6

IL6 goat polyclonal antibody, Aff - Purified

Applications ELISA, FN, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Highly pure (> 98%), 20.9 kDa  E.coli derived recombinant Human IL-6

Goat Anti-IL18 Antibody

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-NPPDNIKDTKSDI, from the internal region of the protein sequence according to NP_001553.1.

Rabbit Polyclonal Anti-IL18 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IL18 antibody: synthetic peptide directed towards the C terminal of human IL18. Synthetic peptide located within the following region: IIFFQRSVPGHDNKMQFESSSYEGYFLACEKERDLFKLILKKEDELGDRS

Rabbit polyclonal IL-1 beta antibody

Applications WB
Reactivities Human, Primate, Dog
Conjugation Unconjugated
Immunogen This antibody was prepared by repeated immunizations with recombinant human IL-1β produced in E.coli. The MW of the recombinant 153 aa IL-1β was 17 kDa with the N-terminal amino acid at position alanine 117. This cleavage site is generated by the IL-1β converting enzyme (ICE, capase-1).