Antibodies

View as table Download

NR4A3 mouse monoclonal antibody, clone OTI5C2 (formerly 5C2)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

RORB mouse monoclonal antibody, clone OTI1G1 (formerly 1G1)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ESR1 (Estrogen Receptor 1/ER) mouse monoclonal antibody, clone OTI1B1 (formerly 1B1)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PR (PgR) mouse monoclonal antibody,clone UMAB137

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

NR4A3 mouse monoclonal antibody, clone OTI2E1 (formerly 2E1)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ESR1 (Estrogen Receptor 1/ER) mouse monoclonal antibody, clone OTI1B1 (formerly 1B1)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PR (PgR) mouse monoclonal antibody,clone UMAB135

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

NR3C1 mouse monoclonal antibody, clone OTI6A12 (formerly 6A12)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ESR1 (Estrogen Receptor 1/ER) mouse monoclonal antibody, clone OTI2E10 (formerly 2E10)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

NR4A3 mouse monoclonal antibody, clone OTI2E1 (formerly 2E1)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-RXRA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-RXRA Antibody: synthetic peptide directed towards the N terminal of human RXRA. Synthetic peptide located within the following region: DTKHFLPLDFSTQVNSSLTSPTGRGSMAAPSLHPSLGPGIGSPGQLHSPI

Rabbit polyclonal GR (Ab-211) antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human GR around the phosphorylation site of serine 211 (N-E-S-P-W).

Carrier-free (BSA/glycerol-free) PGR mouse monoclonal antibody,clone OTI1B3

Applications WB
Reactivities Human
Conjugation Unconjugated

Rabbit polyclonal Nuclear Receptor NR4A1 (Ab-351) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human Nuclear Receptor NR4A1 around the phosphorylation site of serine 351 (L-P-SP-K-P).