Antibodies

Jump to Filters
View as table Download
Retinoid X Receptor alpha (RXRA) Rabbit Polyclonal Antibody
TA332108

USD 539.00

5 Days

Rabbit Polyclonal Anti-RXRA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-RXRA Antibody: synthetic peptide directed towards the N terminal of human RXRA. Synthetic peptide located within the following region: DTKHFLPLDFSTQVNSSLTSPTGRGSMAAPSLHPSLGPGIGSPGQLHSPI
PPAR delta (PPARD) (430-441) Goat Polyclonal Antibody
AP23032PU-N

USD 500.00

2 Weeks

PPAR delta (PPARD) (430-441) goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Human, Bovine, Bat, Canine, Chicken, Equine, Hamster, Monkey, Mouse, Porcine, Rabbit, Rat, Zebrafish
Conjugation Unconjugated
Immunogen Synthetic peptide from the C-terminus of human PPARD