Antibodies

Jump to Filters
View as table Download
DLL4 Rabbit Polyclonal Antibody
AP05661PU-N

USD 550.00

5 Days

DLL4 rabbit polyclonal antibody, Purified

Applications ELISA, IHC, WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to the internal region of human DLL4.
DVL1 Rabbit Polyclonal Antibody
TA329899

USD 485.00

2 Weeks

Rabbit Polyclonal Anti-DVL1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DVL1 antibody: synthetic peptide directed towards the middle region of human DVL1. Synthetic peptide located within the following region: LKITIANAVIGADVVDWLYTHVEGFKERREARKYASSLLKHGFLRHTVNK
NOTCH1 Rabbit Polyclonal Antibody
AP23350PU-N

USD 560.00

2 Weeks

NOTCH1 rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a sequence at the middle region of human NOTCH1