Antibodies

View as table Download

Rabbit Anti-NSE (Neuron specific enolase) Antibody

Applications IF, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Recombinant human NSE expressed in and purified from E. coli

Rabbit Polyclonal Anti-ENO1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human ENO1

Rabbit Polyclonal Anti-HSPA9 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human HSPA9

Rabbit polyclonal anti-NSE / ENO2 antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human NSE.

Rabbit polyclonal anti-HSP60 antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human HSP60.

Rabbit polyclonal anti-HSPD1(HSP60) antibody(Center), Loading control

Applications IF, WB
Reactivities Human (Predicted: Mouse, Rat, Bovine, Chicken, Hamster)
Conjugation Unconjugated
Immunogen This HSPD1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 187-215 amino acids from the Central region of human HSPD1.

Rabbit Polyclonal antibody to PNPase (polyribonucleotide nucleotidyltransferase 1)

Applications IHC, WB
Reactivities Human, Mouse (Predicted: Rat, Cow)
Conjugation Unconjugated
Immunogen Recombinant fragment contain a sequence corresponding to a region within amino acids 25 and 251 of PNPase (Uniprot ID#Q8TCS8)

Rabbit Polyclonal Anti-RQCD1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-RQCD1 antibody is: synthetic peptide directed towards the middle region of Human RQCD1. Synthetic peptide located within the following region: SLGVIGALVKTDEQEVINFLLTTEIIPLCLRIMESGSELSKTVATFILQK

Rabbit anti-ENO1 Polyclonal Antibody

Applications ICC/IF, IHC, IP, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human ENO1

Rabbit Polyclonal NSE Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.

Goat Polyclonal Antibody against DEAD-box protein 6

Applications WB
Reactivities Human (Expected from sequence similarity: Mouse, Rat, Dog)
Conjugation Unconjugated
Immunogen Peptide with sequence C-AEYHSEPVEDEKP, from the C Terminus of the protein sequence according to NP_004388.1.

Rabbit polyclonal CNOT2 (Ab-101) antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human CNOT2 around the phosphorylation site of serine 101 (S-L-SP-Q-G).

Rabbit polyclonal anti-CNOT7 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human CNOT7.

Anti-ENO2 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 420-434 amino acids of Human enolase 2 (gamma, neuronal)

Rabbit polyclonal DCP1A antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human DCP1A.