Antibodies

View as table Download

Rabbit Polyclonal HIF-2 alpha Antibody

Applications ChIP, ELISA, FC, ICC/IF, IHC, Immunoblotting, IP, SDS-PAGE, Simple Western, WB
Reactivities Fish, Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A peptide derived from the C-terminus of mouse/human HIF-2 alpha protein.

Mouse Monoclonal c-Myc Antibody (9E10)

Applications ChIP, ELISA, FC, ICC/IF, IHC, Immunoblotting, IP, Sandwich ELISA, Simple Western, WB
Reactivities Human, Mouse, Drosophila
Conjugation Unconjugated

Mouse Monoclonal p53 Antibody (PAb 240)

Applications CyTOF-ready, ELISA, FC, ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat, Yeast (Does not react with: Xenopus)
Conjugation Unconjugated

Mouse Monoclonal Antibody against HIF-2 alpha (ep190b)

Applications ChIP, ELISA, FC, ICC/IF, IHC, IP, Simple Western, WB
Reactivities Human, Rat
Conjugation Unconjugated

Rabbit Polyclonal HDAC2 Antibody

Applications ELISA, IHC, WB
Reactivities Human, Dog, Rat, Monkey, Mouse
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the C Terminus Region of the target protein.

Rabbit Polyclonal HIF-1 alpha Antibody

Applications ChIP, ELISA, ICC/IF, IHC, Immunoblotting, IP, Simple Western, WB
Reactivities Human, Mouse, Rat, Canine, Guinea Pig, Primate, Xenopus
Conjugation Unconjugated
Immunogen Fusion protein made to an internal sequence of human HIF-1 alpha (containing amino acids 432-528) [UniProt Q16665]

Mouse Monoclonal c-Myc Antibody (9E11)

Applications CyTOF-ready, ELISA, FC, ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Chicken, Yeast
Conjugation Unconjugated

Rabbit Polyclonal c-Myc Antibody

Applications ChIP, ELISA, ICC/IF, IHC, IP, Simple Western, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide made to the human c-Myc protein (between residues 400-450) [UniProt P01106]

Mouse Monoclonal HIF-1 alpha Antibody (H1alpha67)

Applications ChIP, ELISA, FC, ICC/IF, IHC, Immunoblotting, IP, WB
Reactivities Bovine, Ferret, Human, Mouse, Porcine, Primate, Rat, Sheep
Conjugation Unconjugated

Rabbit Polyclonal c-jun Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the Middle Region of the target protein.

Rabbit Polyclonal c-Fos Antibody

Applications ELISA, IHC, WB
Reactivities Human, Dog, Rat, Monkey, Mouse
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.

Rabbit Polyclonal STAT1 alpha Antibody

Applications ELISA, ICC, IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen STAT1 alpha antibody was raised against a peptide corresponding to 38 amino acids near the carboxy terminus of human STAT1 alpha. The sequences differ from the murine corresponding sequences by four amino acids. The immunogen is located within the last 50 amino acids of STAT1 alpha.

PPAR delta (PPARD) (430-441) goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Human, Bovine, Bat, Canine, Chicken, Equine, Hamster, Monkey, Mouse, Porcine, Rabbit, Rat, Zebrafish
Conjugation Unconjugated
Immunogen Synthetic peptide from the C-terminus of human PPARD

Rabbit Polyclonal anti-TP53 antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE