Mouse Monoclonal p53 Antibody (PAb 240)
Applications | CyTOF-ready, ELISA, FC, ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat, Yeast (Does not react with: Xenopus) |
Conjugation | Unconjugated |
Mouse Monoclonal p53 Antibody (PAb 240)
Applications | CyTOF-ready, ELISA, FC, ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat, Yeast (Does not react with: Xenopus) |
Conjugation | Unconjugated |
Rabbit Polyclonal STAT1 alpha Antibody
Applications | ELISA, ICC, IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | STAT1 alpha antibody was raised against a peptide corresponding to 38 amino acids near the carboxy terminus of human STAT1 alpha. The sequences differ from the murine corresponding sequences by four amino acids. The immunogen is located within the last 50 amino acids of STAT1 alpha. |
Rabbit Polyclonal anti-TP53 antibody
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE |
Rabbit Polyclonal anti-TP53 antibody
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: PSQAMDDLMLSPDDIEQWFTEDPGPDEAPRMPEAAPPVAPAPAAPTPAAP |
STAT1 mouse monoclonal antibody, clone AT1F4, Purified
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 425.00
2 Weeks
p53 (TP53) (Wild type + Mutant) (20-31) mouse monoclonal antibody, clone Bp53-11, Aff - Purified
Applications | ELISA, IF, IHC, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
STAT1 mouse monoclonal antibody, clone AT1F4, Purified
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |