Antibodies

View as table Download

TRPV5 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human TRPV5

Rabbit Polyclonal Anti-TRPV5

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide (C)GLNLSEGDGEEVYHF, corresponding to amino acid residues 715-729 of human TRPV5. Intracellular, C-terminus.

Rabbit polyclonal Anti-TRPV5 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TRPV5 antibody: synthetic peptide directed towards the N terminal of human TRPV5. Synthetic peptide located within the following region: MLQQKRILESPLLRASKENDLSVLRQLLLDCTCDVRQRGALGETALHIAA

Rabbit Polyclonal Anti-TRPV5 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human TRPV5

TRPV5 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-325 of human TRPV5 (NP_062815.3).
Modifications Unmodified