Antibodies

Jump to Filters
View as table Download
PRDM5 Rabbit Polyclonal Antibody
TA331191

USD 539.00

5 Days

Rabbit Polyclonal Anti-PRDM5 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PRDM5 antibody: synthetic peptide directed towards the N terminal of human PRDM5. Synthetic peptide located within the following region: GPFAGEKRMPEDLDENMDYRLMWEVRGSKGEVLYILDATNPRHSNWLRFV
PRDM5 (100-200) Rabbit Polyclonal Antibody
AP08400PU-N

USD 500.00

2 Weeks

PRDM5 (100-200) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a portion of amino acids 100-200 of human PRDM5 protein.