Antibodies

Jump to Filters
View as table Download
KLF8 Rabbit Polyclonal Antibody
TA329322

USD 539.00

5 Days

Rabbit Polyclonal anti-KLF8 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KLF8 antibody: synthetic peptide directed towards the N terminal of human KLF8. Synthetic peptide located within the following region: LSFHKPKAPLQPASMLQAPIRPPKPQSSPQTLVVSTSTSDMSTSANIPTV