Antibodies

Jump to Filters
View as table Download
CENPA Rabbit Polyclonal Antibody
TA338983

USD 485.00

5 Days

Rabbit Polyclonal Anti-CENPA Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CENPA antibody: synthetic peptide directed towards the N terminal of human CENPA. Synthetic peptide located within the following region: MGPRRRSRKPEAPRRRSPSPTPTPGPSRRGPSLGASSHQHSRRRQGWLKE
CENPA Rabbit Polyclonal Antibody
TA311922

USD 380.00

In Stock

Rabbit polyclonal anti-CENPA antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CENPA.