Anti-ALDH3A1 mouse monoclonal antibody, clone OTI1B6 (formerly 1B6)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Anti-ALDH3A1 mouse monoclonal antibody, clone OTI1B6 (formerly 1B6)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ALDH3A1 mouse monoclonal antibody, clone OTI1B6 (formerly 1B6)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Anti-ALDH3A1 mouse monoclonal antibody, clone OTI1C6 (formerly 1C6)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 509.00
2 Weeks
Anti-ALDH3A1 mouse monoclonal antibody, clone OTI1B6 (formerly 1B6), Biotinylated
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
Anti-ALDH3A1 mouse monoclonal antibody, clone OTI1B6 (formerly 1B6), HRP conjugated
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | HRP |
Carrier-free (BSA/glycerol-free) ALDH3A1 mouse monoclonal antibody, clone OTI1C6 (formerly 1C6)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 509.00
2 Weeks
Anti-ALDH3A1 mouse monoclonal antibody, clone OTI1C6 (formerly 1C6), Biotinylated
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
Anti-ALDH3A1 mouse monoclonal antibody, clone OTI1C6 (formerly 1C6), HRP conjugated
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | HRP |
Anti-ALDH3A1 mouse monoclonal antibody, clone OTI1B6 (formerly 1B6)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Anti-ALDH3A1 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 300 amino acids of human aldehyde dehydrogenase 3 family, member A1 |
Anti-ALDH3A1 mouse monoclonal antibody, clone OTI1C6 (formerly 1C6)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Anti-ALDH3A1 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 300 amino acids of human aldehyde dehydrogenase 3 family, member A1 |
Rabbit Polyclonal Anti-ALDH3A1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ALDH3A1 antibody: synthetic peptide directed towards the N terminal of human ALDH3A1. Synthetic peptide located within the following region: DLHKNEWNAYYEEVVYVLEEIEYMIQKLPEWAADEPVEKTPQTQQDELYI |
ALDH3A1 rabbit polyclonal antibody, Purified
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide selected from the Center region of human ALDH3A1. |
Goat Anti-ALDH3A1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-RYPPSPAKMTQH, from the C Terminus of the protein sequence according to NP_000682.3. |