Antibodies

Jump to Filters

View as table

Loading...

Download Close

Download

1 - 13 of 13 results

(reset)

MAK Mouse Monoclonal Antibody [Clone ID: OTI1G2]

TA808770

USD 447.00

In Stock

MAK mouse monoclonal antibody,clone OTI1G2

Applications	IHC, WB
Reactivities	Human, Rat
Conjugation	Unconjugated

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

MAK Mouse Monoclonal Antibody [Clone ID: OTI5A7]

TA808843

USD 447.00

In Stock

MAK mouse monoclonal antibody,clone OTI5A7

Applications	IHC, WB
Reactivities	Human, Rat
Conjugation	Unconjugated

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

MAK Mouse Monoclonal Antibody [Clone ID: OTI1G2]

CF808770

USD 600.00

3 Days

Carrier-free (BSA/glycerol-free) MAK mouse monoclonal antibody,clone OTI1G2

Applications	IHC, WB
Reactivities	Human, Rat
Conjugation	Unconjugated

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

MAK Mouse Monoclonal Antibody [Clone ID: OTI5A7]

CF808843

USD 600.00

3 Days

Carrier-free (BSA/glycerol-free) MAK mouse monoclonal antibody,clone OTI5A7

Applications	IHC, WB
Reactivities	Human, Rat
Conjugation	Unconjugated

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

MAK Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1G2]

TA808770AM

USD 509.00

2 Weeks

MAK mouse monoclonal antibody,clone OTI1G2, Biotinylated

Applications	IHC, WB
Reactivities	Human, Rat
Conjugation	Biotin

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

MAK Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1G2]

TA808770BM

USD 509.00

2 Weeks

MAK mouse monoclonal antibody,clone OTI1G2, HRP conjugated

Applications	IHC, WB
Reactivities	Human, Rat
Conjugation	HRP

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

MAK Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5A7]

TA808843AM

USD 509.00

2 Weeks

MAK mouse monoclonal antibody,clone OTI5A7, Biotinylated

Applications	IHC, WB
Reactivities	Human, Rat
Conjugation	Biotin

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

MAK Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5A7]

TA808843BM

USD 509.00

2 Weeks

MAK mouse monoclonal antibody,clone OTI5A7, HRP conjugated

Applications	IHC, WB
Reactivities	Human, Rat
Conjugation	HRP

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

MAK Mouse Monoclonal Antibody [Clone ID: OTI1G2]

TA808770S

USD 200.00

2 Days

MAK mouse monoclonal antibody,clone OTI1G2

Applications	IHC, WB
Reactivities	Human, Rat
Conjugation	Unconjugated

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

MAK Mouse Monoclonal Antibody [Clone ID: OTI5A7]

TA808843S

USD 200.00

2 Days

MAK mouse monoclonal antibody,clone OTI5A7

Applications	IHC, WB
Reactivities	Human, Rat
Conjugation	Unconjugated

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

MAK Rabbit Polyclonal Antibody

TA346423

USD 539.00

5 Days

Rabbit Polyclonal Anti-MAK Antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-MAK antibody: synthetic peptide directed towards the C terminal of human MAK. Synthetic peptide located within the following region: WNTKTGRGQFSGRTYNPTAKNLNIVNRAQPIPSVHGRTDWVAKYGGHR

1 / 3

2 / 3

3 / 3

Previous Next

MAK (C-term) Rabbit Polyclonal Antibody

AP14179PU-N

USD 580.00

2 Weeks

MAK (C-term) rabbit polyclonal antibody, Purified

Applications	IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	This antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide selected from the C-terminal region of human MAK.

1 / 2

2 / 2

Previous Next

MAK Rabbit Polyclonal Antibody

TA378212

USD 365.00

3 Weeks

MAK Rabbit polyclonal Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 370-435 of human MAK (NP_005897.1).
Modifications	Unmodified

1 - 13 of 13 results