Antibodies

Jump to Filters
View as table Download
Gelsolin (GSN) Rabbit Polyclonal Antibody
TA323717

USD 380.00

In Stock

Anti-GSN Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 768-782 amino acids of Human gelsolin
Gelsolin (GSN) Rabbit Polyclonal Antibody
TA323718

USD 380.00

In Stock

Anti-GSN Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 768-782 amino acids of Human gelsolin
Gelsolin (GSN) Rabbit Polyclonal Antibody
TA336242

USD 539.00

5 Days

Rabbit Polyclonal Anti-GSN Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-GSN Antibody: synthetic peptide directed towards the C terminal of human GSN. Synthetic peptide located within the following region: KPMIIYKGGTSREGGQTAPASTRLFQVRANSAGATRAVEVLPKAGALNSN
Gelsolin (GSN) Mouse Monoclonal Antibody [Clone ID: GEL-42]
AM20623PU-N

USD 560.00

2 Weeks

Gelsolin (GSN) mouse monoclonal antibody, clone GEL-42, Purified

Applications IHC, WB
Reactivities Human, Rabbit
Conjugation Unconjugated