Antibodies

View as table Download

SOD1 (Superoxide Dismutase 1) mouse monoclonal antibody, clone OTI8B10 (formerly 8B10)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) SOD1 mouse monoclonal antibody, clone OTI8B10 (formerly 8B10)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated

SOD1 (Superoxide Dismutase 1) mouse monoclonal antibody, clone OTI8B10 (formerly 8B10)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated

SOD1 mouse monoclonal antibody, clone 8B10, Biotinylated

Applications FC, IHC, WB
Reactivities Human
Conjugation Biotin

Rabbit Polyclonal Anti-SOD1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SOD1 antibody: synthetic peptide directed towards the N terminal of human SOD1. Synthetic peptide located within the following region: MATKAVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHE

Rabbit anti-SOD1 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human SOD1