Antibodies

Jump to Filters
View as table Download
PNPT1 Rabbit Polyclonal Antibody
TA315960

USD 380.00

In Stock

Rabbit polyclonal anti-PNPT1 antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human PNPT1.
AK3 Mouse Monoclonal Antibody [Clone ID: OTI6G4]
TA501863S

USD 200.00

2 Days

AK3 mouse monoclonal antibody, clone OTI6G4 (formerly 6G4)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
CAD Rabbit Polyclonal Antibody
TA313542

USD 380.00

4 Weeks

Rabbit polyclonal anti-CAD antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human CAD.
PNPT1 Rabbit Polyclonal Antibody
TA343959

USD 539.00

5 Days

Rabbit Polyclonal Anti-PNPT1 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PNPT1 antibody: synthetic peptide directed towards the middle region of human PNPT1. Synthetic peptide located within the following region: CGGSLALMDSGVPISSAVAGVAIGLVTKTDPEKGEIEDYRLLTDILGIED
RRM1 Mouse Monoclonal Antibody [Clone ID: OTI17C3]
TA804723S

USD 200.00

2 Days

RRM1 mouse monoclonal antibody, clone OTI17C3 (formerly 17C3)

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
RRM1 Mouse Monoclonal Antibody [Clone ID: OTI2D10]
TA804875S

USD 200.00

2 Days

RRM1 mouse monoclonal antibody, clone OTI2D10 (formerly 2D10)

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
POLR2A (794-822) Mouse Monoclonal Antibody [Clone ID: ARNA-3]
BM5528

USD 425.00

2 Weeks

POLR2A (794-822) mouse monoclonal antibody, clone ARNA-3, Supernatant

Applications IF, IHC, WB
Reactivities Drosophila, Human
Conjugation Unconjugated
CAD Rabbit Polyclonal Antibody
TA313543

USD 380.00

In Stock

Rabbit polyclonal CAD (Thr456) antibody(Phospho-specific)

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human CAD around the phosphorylation site of threonine 456 (P-I-TP-P-H).
Modifications Phospho-specific