Rabbit Polyclonal Anti-WNT10B Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WNT10B antibody: synthetic peptide directed towards the middle region of human WNT10B. Synthetic peptide located within the following region: GTSGSCQFKTCWRAAPEFRAVGAALRERLGRAIFIDTHNRNSGAFQPRLR |
Rabbit Polyclonal Anti-FZD5 Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FZD5 antibody: synthetic peptide directed towards the middle region of human FZD5. Synthetic peptide located within the following region: CYLYEQHYRESWEAALTCACPGHDTGQPRAKPEYWVLMLKYFMCLVVGIT |
Mouse anti p53 Monoclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
GLI1 mouse monoclonal antibody, clone OTI4A8 (formerly 4A8)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
beta Catenin (CTNNB1) mouse monoclonal antibody, clone IMD-110, Purified
| Applications | IF, IHC, WB |
| Reactivities | Chicken, Human, Rat |
| Conjugation | Unconjugated |
Rabbit polyclonal p53 (Phospho-Thr387) antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human p53 around the phosphorylation site of threonine 387 (F-K-TP-E-G). |
| Modifications | Phospho-specific |
WNT9A (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminal of human WNT9A |
Rabbit polyclonal beta-Catenin (Ser37) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human β-Catenin around the phosphorylation site of serine 37 (I-H-SP-G-A). |
| Modifications | Phospho-specific |
Germany
Japan
United Kingdom
China
