Antibodies

Jump to Filters
View as table Download
GBA3 Mouse Monoclonal Antibody [Clone ID: OTI5G5]
TA502533S

USD 200.00

2 Days

GBA3 mouse monoclonal antibody, clone OTI5G5 (formerly 5G5)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
GBA3 (C-term) Rabbit Polyclonal Antibody
AP51789PU-N

USD 580.00

2 Weeks

GBA3 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 295-325 amino acids from the C-terminal region of Human Cytosolic beta-glucosidase
SHMT2 Rabbit Polyclonal Antibody
TA339281

USD 485.00

5 Days

Rabbit Polyclonal Anti-SHMT2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SHMT2 antibody: synthetic peptide directed towards the N terminal of human SHMT2. Synthetic peptide located within the following region: ELIASENFCSRAALEALGSCLNNKYSEGYPGKRYYGGAEVVDEIELLCQR
SHMT2 Rabbit Polyclonal Antibody
TA339282

USD 539.00

5 Days

Rabbit Polyclonal Anti-SHMT2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SHMT2 antibody: synthetic peptide directed towards the C terminal of human SHMT2. Synthetic peptide located within the following region: ELVSITANKNTCPGDRSAITPGGLRLGAPALTSRQFREDDFRRVVDFIDE
GBA3 Mouse Monoclonal Antibody [Clone ID: OTI3E8]
TA502516S

USD 200.00

2 Days

GBA3 mouse monoclonal antibody, clone OTI3E8 (formerly 3E8)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
GGT1 Rabbit Polyclonal Antibody
TA327174

USD 365.00

3 Weeks

GGT1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human GGT1